Bamboo personalised photo frame


Out of stock
People are viewing this right now
All products are personalised & generally dispatched within 10 business days.
Click here to view shipping information. hoursminutes

★★★★★ 2000+ five star Reviews

apple paymasterpaypalvisaafterpayklarna

Etched Floral motif on 3mm eco friendly sustainable bamboo.

Suitable for Mum, Gran, Nanna, Aunty - anyone you can think of.

Wording is completely customisable - leave the exact wording you would like us to etch in the space provided.

Simple to assemble, just sticky tape your photo to the back of the frame, and slot it into the  2 x bamboo desk stands to stand it up. You can easily sit the frame in the stand to have it in a standing position, or blu tac it to a wall etc. It's designed in the landscape position to suit a standard size photo.

* please note that there is no glass or clear perspex in this frame

* measures 17cm wide x 14cm high

Not enough items available. Only [max] left.