PERSONALISE NOW. PAY LATER WITH AFTERPAY & KLARNA.
Sold out

Personalised Protein Shaker

$36.95

Select Colour: Choose an option

  • Black
  • Mint
  • Pink

Notify me when this product is available:

People are viewing this right now

★★★★★ 2000+ five star Reviews

apple paymasterpaypalvisaafterpayklarna

Our personalised protein shakers are exactly what you need to keep your morning smoothies and post workout protein shake nice and cool. Our shakers include shaker ball. 

Various colour and font combinations available.

Food grade stainless steel, BPA free. Double wall insulation keeps drinks cold, and best of all - they don't sweat. 

  • Large-mouth design easily fits ice cubes and makes cleaning a breeze
  • 750mL capacity
  • Portable, reusable, and recyclable
  • Double-walled, sweat-proof body equals protection from messy condensation leaks
  • NOTE - Not intended for children under the age of 3 years due to small parts
  • Note that the font size will be entirely dependant on the number of characters entered in the engraving field
  • hand wash only
  • note that we cannot engrave emojis 
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Browse WishlistRemove Wishlist